PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do018662.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 360aa    MW: 36130.4 Da    PI: 8.2186
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do018662.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.7e-3941101262
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 +e+ l+cprCds ntkfCyynnyslsqPr+fCk+CrryWtkGGalrnvPvGgg+rknk+s+
  Do018662.1  41 PEQGLRCPRCDSPNTKFCYYNNYSLSQPRHFCKTCRRYWTKGGALRNVPVGGGCRKNKRSR 101
                 67899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027017.5E-334399IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-274498IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6094599IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MASSTAVAAG DDAVGARKSG TGGADGGVAP PPATQQPPPP PEQGLRCPRC DSPNTKFCYY  60
NNYSLSQPRH FCKTCRRYWT KGGALRNVPV GGGCRKNKRS RSAAAVAAAA AAASSRLSLN  120
LPVEGVVGDQ QARLGFLGGA PVASSPIAVG GAPASDYQQQ AAGAAVGMMA LPRLHAPAVA  180
QYVPFGEWPS GVGDIPGGGG GHAMNGGGAH AGAVSSSIAS SIESLSFINQ DLHWKLQQQR  240
LATMFLGPPP PTSSAAHVDG IPPAAAHVSG AFLQMAAPPG MESTMPAATS WFMDSSYGVL  300
PSPPAHGNNT AAAIAAATTN CNVVNSGRSS GDDDSATAPN NNCGSAIPSW GDMSTFAMLP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9475241e-108EU947524.1 Zea mays clone 346044 mRNA sequence.
GenBankKJ7269771e-108KJ726977.1 Zea mays clone pUT3678 C2C2-DOF transcription factor (DOF32) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982507.11e-140PREDICTED: dof zinc finger protein DOF5.7-like
TrEMBLK4ABQ41e-140K4ABQ4_SETIT; Uncharacterized protein
STRINGSi036311m1e-140(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.13e-33Dof family protein